Compendium
Growth Hormone

Tesamorelin

Tesamorelin is an FDA-approved synthetic GHRH analog used to treat excess abdominal fat in HIV-infected patients. It reduces visceral adipose tissue and improves metabolic markers.

Protocol

1–2 mg subcutaneous daily

Half-Life

25–38 minutes

Molecular Structure & Chemistry

44 residues • 711 atoms • Skeletal Formula

Formula

C215H357N71O67S

Molar Mass

4,248.06 g/mol

Exact Mass

5037.645 Da

Isoelectric Pt

10.78

Charge pH 7

+4

GRAVY

-0.8

Hover Cα carbons for residue info

Amino Acid Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Biological Mechanisms

Visceral fat reduction

Observed in clinical research as a primary mechanism of action for Tesamorelin.

Improved lipid profile

Observed in clinical research as a primary mechanism of action for Tesamorelin.

Increased GH and IGF-1

Observed in clinical research as a primary mechanism of action for Tesamorelin.

Cognitive improvement in older adults

Observed in clinical research as a primary mechanism of action for Tesamorelin.

Lean mass preservation

Observed in clinical research as a primary mechanism of action for Tesamorelin.

Safety & Risk Analysis

Peripheral edemaArthralgiaMyalgiaGlucose dysregulation

Critical Safety Warning

Black market peptides can be contaminated, mislabeled, or dangerous. Only obtain peptides via a registered doctor and legitimate pharmacy. Never attempt self-administration without professional medical supervision.

Community Journey Log

Log Your Journey

Share your research observations with the community.

Sign in to contribute

Create a free account to log your research journey and share observations with the community.

Community Observations (0)

No journey logs yet. Be the first to share.

Quick Reference

CategoryGrowth Hormone
Half-Life25–38 minutes
AdminSubcutaneous
Download Research PDF
Medical Note

This compound is for research purposes only. Clinical applications must be directed by a licensed physician.

View Community Logs